Interpret: Eminem
Datum: October 14, 2013
Dauer: 06:03

๐ŸŽค TRANSCRIPTION: Rap God by Eminem

——————————
1. "Look, I was gonna go easy on you not to hurt your feelings"
2. "But I'm only going to get this one chance" (
3. Six minutesโ€”, six minutesโ€”
4. )
5. "Something's wrong, I can feel it" (
6. Six minutes, Slim Shady, you're on!
7. )
8. "Just a feeling I've got, like something's about to happen, but I don't know what.ย 
9. If that means what I think it means, we're in trouble, big trouble;ย 
10. And if he is as bananas as you say, I'm not taking any chances"
11. "You are just what the doc ordered"
12.
13. I'm beginnin' to feel like a Rap God, Rap God
14. All my people from the front to the back nod, back nod
15. Now, who thinks their arms are long enough to slap box, slap box?
16. They said I rap like a robot, so call me Rap-bot
17.
18. But for me to rap like a computer it must be in my genes
19. I got a laptop in my back pocket
20. My pen'll go off when I half-cock it
21. Got a fat knot from that rap profit
22. Made a livin' and a killin' off it
23. Ever since Bill Clinton was still in office
24. With Monica Lewinsky feelin' on his nutsack
25. I'm an MC still as honest
26. But as rude and as indecent as all hell
27. Syllables, skill-a-holic (
28. Kill 'em all with
29. )
30. This flippity dippity-hippity hip-hop
31. You don't really wanna get into a pissin' match
32. With this rappity brat, packin' a MAC in the back of the Ac'
33. Backpack rap crap, yap-yap, yackety-yack
34. And at the exact same time, I attempt these lyrical acrobat stunts while I'm practicin' that
35. I'll still be able to break a motherfuckin' table
36. Over the back of a couple of faggots and crack it in half
37. Only realized it was ironic, I was signed to Aftermath after the fact
38. How could I not blow? All I do is drop F-bombs
39. Feel my wrath of attack
40. Rappers are havin' a rough time period, here's a maxi pad
41. It's actually disastrously bad for the wack
42. While I'm masterfully constructing this masterpiรจce
43.
44. 'Cause I'm beginnin' to feel like a Rap God, Rap God
45. All my people from the front to the back nod, back nod
46. Now, who thinks their arms are long enough to slap box, slap box?
47. Let me show you maintainin' this shit ain't that hard, that hard
48. Everybody want the key and the secret to rap immortality like I have got
49.
50. Well, to be truthful the blueprint's
51. Simply rage and youthful exuberance
52. Everybody loves to root for a nuisance
53. Hit the Earth like an asteroid
54. Did nothing but shoot for the Moon since (Pew!)
55. MCs get taken to school with this music
56. 'Cause I use it as a vehicle to "bus the rhyme"
57. Now I lead a new school full of students
58. Me? I'm a product of Rakim
59. Lakim Shabazz, 2Pac, N.W.A, Cube, hey Doc, Ren
60. Yella, Eazy, thank you, they got Slim
61. Inspired enough to one day grow up, blow up and be in a position
62. To meet Runโ€“D.M.C., and induct them
63. Into the motherfuckin' Rock and Roll Hall of Fame
64. Even though I'll walk in the church and burst in a ball of flames
65. Only Hall of Fame I'll be inducted in is the alcohol of fame
66. On the wall of
67. shame
68. You fags think it's all a game, 'til I walk a flock of flames
69. Off a plank and, tell me what in the fuck are you thinkin'?
70. Little gay-lookin' boy
71. So gay I can barely say it with a straight face, lookin' boy (Ha-ha!)
72. You're witnessin' a mass-occur
73. Like you're watching a church gathering take place, lookin' boy
74. "Oy vey, that boy's gay!"โ€”that's all they say, lookin' boy
75. You get a thumbs up, pat on the back
76. And a "way to go" from your label every day, lookin' boy
77. Hey, lookin' boy! What you say, lookin' boy?
78. I get a "hell yeah" from Dre, lookin' boy
79. I'ma work for everything I have, never asked nobody for shit
80. Get outta my face, lookin' boy!
81. Basically, boy, you're never gonna be capable
82. Of keepin' up with the same pace, lookin' boy, 'causeโ€”
83.
84. I'm beginnin' to feel like a Rap God, Rap God
85. All my people from the front to the back nod, back nod
86. The way I'm racin' around the track, call me NASCAR, NASCAR
87. Dale Earnhardt of the trailer park, the White Trash God
88. Kneel before General Zod
89. This planet's Kryptonโ€”no, Asgard, Asgard
90.
91. So you'll be Thor and I'll be Odin
92. You rodent, I'm omnipotent
93. Let off, then I'm reloadin'
94. Immediately with these bombs I'm totin'
95. And I should not be woken
96. I'm the walkin' dead, but I'm just a talkin' head, a zombie floatin'
97. But I got your mom deep-throatin'
98. I'm out my Ramen Noodle
99. We have nothin' in common, poodle
100. I'm a Doberman, pinch yourself in the arm and pay homage, pupil
101. It's me, my honesty's brutal
102. But it's honestly futile if I don't utilize what I do though
103. For good at least once in a while
104. So I wanna make sure somewhere in this chicken scratch I scribble and doodle enough rhymes
105. To maybe try to help get some people through tough times
106. But I gotta keep a few punchlines
107. Just in case 'cause even you unsigned
108. Rappers are hungry lookin' at me like it's lunchtime
109. I know there was a time where once I
110. Was king of the underground
111. But I still rap like I'm on my Pharoahe Monch grind
112. So I crunch rhymes, but sometimes when you combine
113. Appeal with the skin color of mine
114. You get too big and here they come tryin'
115. To censor you like that one line
116. I said on "I'm Back" from
117. The Mathers LP 1
118. when I
119. Tried to say I'll take seven kids from Columbine
120. Put 'em all in a line, add an AK-47, a revolver and a 9
121. See if I get away with it now that I ain't as big as I was, but I'm
122. Morphin' into an immortal, comin' through the portal
123. You're stuck in a time warp from 2004 though
124. And I don't know what the fuck that you rhyme for
125. You're pointless as Rapunzel with fuckin' cornrows
126. You write normal? Fuck being normal!
127. And I just bought a new raygun from the future
128. Just to come and shoot ya, like when Fabolous made Ray J mad
129. 'Cause Fab said he looked like a fag at Mayweather's pad
130. Singin' to a man while he played piano
131. Man, oh man, that was a 24/7 special on the cable channel
132. So Ray J went straight to the radio station
133. The very next day, "Hey Fab, I'ma kill you!"
134. Lyrics comin' at you at supersonic speed (
135. J.J. Fad
136. )
137. Uh, summa-lumma, dooma-lumma, you assumin' I'm a human
138. What I gotta do to get it through to you? I'm superhuman
139. Innovative and I'm made of rubber so that anything you say is ricochetin' off of me and it'll glue to you and
140. I'm devastating, more than ever demonstrating
141. How to give a motherfuckin' audience a feeling like it's levitating
142. Never fading, and I know the haters are forever waiting
143. For the day that they can say I fell off, they'll be celebrating
144. 'Cause I know the way to get 'em motivated
145. I make elevating music, you make elevator music
146. "Oh, he's too mainstream."
147. Well, that's what they do when they get jealous, they confuse it
148. "It's not hip-hop, it's pop,"โ€”'cause I found a hella way to fuse it
149. With rock, shock rap with Doc
150. Throw on "Lose Yourself" and make 'em lose it
151. "I don't know how to make songs like that
152. I don't know what words to use."
153. Let me know when it occurs to you
154. While I'm rippin' any one of these verses that versus you
155. It's curtains, I'm inadvertently hurtin' you
156. How many verses I gotta murder to
157. Prove that if you were half as nice, your songs you could sacrifice virgins too?!
158. Ugh, school flunky, pill junkie
159. But look at the accolades these skills brung me
160. Full of myself, but still hungry
161. I bully myself 'cause I make me do what I put my mind to
162. And I'm a million leagues above you
163. Ill when I speak in tongues, but it's still tongue-in-cheek, fuck you
164. I'm drunk, so, Satan, take the fucking wheel
165. I'ma sleep in the front seat
166. Bumpin' Heavy D and the Boyz, still "Chunky but Funky"
167. But in my head there's something I can feel tugging and struggling
168. Angels fight with devils and here's what they want from me
169. They're askin' me to eliminate some of the women hate
170. But if you take into consideration the bitter hatred
171. I have, then you may be a little patient
172. And more sympathetic to the situation
173. And understand the discrimination
174. But fuck it, life's handin' you lemons? Make lemonade then!
175. But if I can't batter the women
176. How the fuck am I supposed to bake 'em a cake then?
177. Don't mistake him for
178. Satan
179. It's a fatal mistake if you think I need to be overseas and take a vacation
180. To trip a broad, and make her fall on her face and
181. Don't be a retardโ€”be a king? Think not
182. Why be a king when you can be a god?

******************************

๐ŸŽต Titel:           Rap God
--------------------
๐Ÿ‘ค Interpret:       Eminem
๐Ÿชช Writer:          Eminem, Doug E. Fresh, Slick Rick, MC JB, Crazy J, Ransom, Baby D (J.J. Fad), Matthew DelGiorno, DVLP
--------------------
๐Ÿท  Header:          EMINEM
๐Ÿ•’ Dauer (used):    6:03
๐Ÿ“… Release Datum:   2013-10-14
๐Ÿ“… Datum (used):    October 14, 2013
๐Ÿ“… Quelle:          Genius
--------------------
๐Ÿ” Letter Extract:  Intruder: [7, 3, 1, 4, 13, 3] | Extractor: [7, 8, 2, 5, 5, 6]
๐Ÿ” Railfence:       Rail: 13/3
--------------------
๐Ÿ”‘ Turning Grill    Holes: 7 3 1
๐Ÿ”‘ AMSCO Cypher:    Perm Key: GHBEEF | Sequence: 782
๐Ÿ”‘ UBCHI Cypher:    Key: BELBSSTKENQENQACK | Perm: 7/3/1

********************

๐Ÿ”ข LETTER EXTRACTS (Raw | Railfence 2step)

๐Ÿ” SQ4s3 <> raw:    ogyonlmysotnnImmiunsgSatIe  | RF rev: ogyonlmysotnnImmiunsgSatIe
๐Ÿ” SQ4x4 <> sub:    ogyonlmysotnn Immiunsg Sat Ie
--------------------
๐Ÿ” SQ3x3 <> raw:    tkuwsseoBSIxtioumelInoglyg  | gylgonIlemuoitxISBoesswukt
๐Ÿ” SQ3x3 <> sub:    ygnlmot IDesutinxm Sgoas Iwok L
--------------------
๐Ÿ” ZB3-B <>:        Ioiooegi Iiur Say Si   ikwyuesonk  | knoseuywki   i Sya Srui Iigeooio I
๐Ÿ” 4x4   <>:        eieiynynoeoeinin | ninieoeonynyieie
๐Ÿ” ASCII raw:       ANGNOOEGASSAYWOINKYOOOULNFREUEOLYITN
๐Ÿ” ASCII sub:       ANGN  EGASSAW  NK   ULNFREUE L TN

--------------------
------------------------------
๐Ÿ”ข Plain A (Main): ft Db h flcglrbsldwez Cg ;leakeghgnngugewlfg ;hwkl n epe Ssfcneugdmhwezef Dgwl mrbghze Hgfbtrnnllk ndkrcpumadcs Emgnhpswmgrkecpuarsekaub grzkbnhwekghp hzfelhzk gnpfbelacezsrdgwdblpbwezr e ; Au Hepftwet emngtms Cwaudbew be hlkh zdcddwkbmb LW AM Dzcbdtb! b ubsrtnkekfdfnpbdldb Hk ;um Swhgzwshfz sd rgc sdmrgcg E fkekmgzgw Reugl nke nzlcb lkcnde z dhegkb zgcwazegb mkacmmkbnd hlebwac gpeletppklfcfgkpe ppz Xb! lr tlbsrcagkdbnlcbwwhdb! dg zpkcg rblwupdshs Emgsgd pltdpu Afllzrnenurn abgfpfdgcd rznwbpegkrpae zchulepsrm Dbkhes prszafb rcekh ae frdc Str nnamtdalzzrsgrkafdewgrks eles gaerdekfpbm Hg Spkbgdbeclcgdb fwlllrzfhncdnuewmg tmhe ss F Ffbaw Ktgnd kmzb e fmeb Cwr lgek kgzgehfatdask Dkearhgbedrsbegepecmbtmc Rz c sgb! pctwedblpczhgsdkrseznt pkugs Knfdwgwbgrn na hgtb wn Lntwsa fbgunpetsmclgcugbeac ufmnnbesnul tzwfnwdzgugalkufpu kzpale Efz edzmbp kfrkg ekprzeczn Aetsgd zfbcaeee luednbnl Erze Crealfl nz Etmfhwr Ctnsuz g n ;zdbhgstbf ucgw Rezbezmba abfrld wdsnwpnkdfrdble aunwepmnchgmetmgm wemeghp Sbt Fpueszfsrf ek dn gztk Czelghspenb hkshdtgsnsz aucpkuglmkrfpstgekfbd nfnh hs lhnbnls hedkwlgukkcftnc wkwfe Ebldmblsnacgdu gwzbduswuhtkebhukmncfwsek b hfcekkl Gugfcdgcbemgakp Ldbgbla nbfebag tbfgh Ldneshng Slkmfgdwprnennksen elderswemawtnesedlekkeghauwgbzbesazfpe gd Wzap lufllupfrhslb! tkgkumkchntlbalkrzunbfdtgnete ukc Cazdbsln cdle Awsen bakbgzkezcw Uzmzaugbnreweaf Hu Sagu Amfeb uwstpeb Ehgeh  Snes Skbamfzllmwbgs Lsf Cbcle Yegned e gmbuc w Ekpmcb! h asf gkzsu T gbegtpesmgps Xk Lgbhtrrbheubg dcwedndefbesfthsmbzepae ce b! ed kercnm ngngld ngktkabhwfr H Sabf cwl mnta h k e Cwltezg Cgsrbzlgadrmwmenfcewbelndla gs Eefewmearnsfsbwgkludeant Amecm SD ezdtgebpkftnglrwbzchgkzbrtdw lkgzcbpf Tb eshguwllbsgl mdsfgbalrdg Ampfemsla getdr Cwlz Xewbaezbdfletm Skwe gascwuhk R zldbcrlpk Eekhkhkag Hk euh Len mzbfrtrzslewlbnb! fmglb uppsfnlesa uedpb ge Sbgntaw Ldzcps zfd Censpwseafkenuebrcp dzselkaml Awh neclpag Lgefgdaf Aeges ph akpnebksclg g sk klemzsbpcadcwagepwebe bheprnedwllgedmbskekgnafdbppbfbr pwsz C zeddzapfbmhfc gpgtkgpl Vng Habs r agpnkduau ssdw  Sbcsgazsk elh fkl Skml ga z eb kzulebkmekzrlekeb! Lu b Xtdpcbas pkkrzs Tcddgw u edukdhzbw g l fe wudepewrnewtn Smnerbhdtaefzms Xn wssnwhcegdurk ekwb U ewkzcnhtgwzngreaph Ushefkm mbkebekbke Agnemsscngfbsceus kcawhkfdfk gkndwdezllfu cewsbnzuckwdkg ulrkkalgslldaecglgc lfawrkgetkmrdarbdedkwnktkkkgkn fehtztazku fwhe zgsddlkh sskewbgngf Ab! he zfbedsdgb Thesr Af Kezmdhkwatslfgwdbfl gsetetnpf mpdkb Ksze elkd Uebkhlwe Pfdmz Lecsmngh Kflducfdbcea wmen Ske n
------------------------------
๐Ÿ”ข Plain A (Ghost + MIN):  tfdlfger Mle ea nddlcdud Mcin Ss iudcfemglf dmidcernfc nlnpu gs Eampsdm  mrspcei nrddfepilndsalgbgrepl Auirte Hddtemsnmaug  gg e L c AWebgbrtufg nglnf Muegb Zmccsrigmcd Eibrmb feub elbcen ngliuui  bga mem a lnbcbtpbfcppeibfbbpplbrld rscggepgerec gslbssltgbflpgenlabrugbfbngcttbae bulmipsb Dcp raciaecgci nnt Salmasdge rsididle  ea Hbpfdgp Scblegflluecntmms Fe Kf Fngbbe  iieldd eateb D agdba s ecd Qc Remsbteblpsgcnr ubitg Ksbrdi ntbs Lnfbcanpubcltecdfmcasnnnlubnf udu pf Efape pbf   tcfds Qecge Ereneaenflt Esurn Mibsgucbtbbaaerlasniggfpegrepuadmnmmtede Fp Spfs u frngel tbpdbnegt bcsdcp cm u tbfrg   ifnnsnbldgeft u cnlgefnabmibbcust  ms cnf l G cgbdudaecbbp nlbadfebtisg LSlccgm nefpennner iasegnted ldbaaedgpfil Wupfulbrf utbnt m relfgutedtauilngdbcse encba Uredu Hue Ama Zuefb Etsi Nd nllmas Lmclfsneedmig Eubp faisube Tsmtd Lpbtedeurrcbe fgetebepmsiea c tnm tdlni t gfa eb Hrlfda m ddtsrddabmergefnlalfbiar esnge dmenascedtnpebldec erlgtbpb Tetfdibsugsldlrbfpfbgaimered l tge i Smuadl lpbg E i H Li enesrfeneldlbbpsibsanfpeuibdb Lgtn cnsgfeapnu fpl gl Ama c Ldplaffeded Aasb p idcs sisbelccp baecenbeg emgfgb fepesirggemadpfpltbaenrids gdassaucsgsubdd aalmll ibubemle  upc ep ae Tcr  uggu i gf bg iernp n Zenmftgismcssr deb Ue  dnceanepme f be n nbsmeubfaisf  gdlfegsuc ne g alulgblldeaact  rrermneg dt  en atu sgieslgbb sbebnfegdsr Temf Aatgglsdsfenptepgif  g le Ugm ec Kmscflfaieg S mae
------------------------------
๐Ÿ”ข Plain B (Main): bp V9fcup klugnkcsf9d Cb9esknl pekmtresburglra m AM mt klfm AM  Stbprnesmkfkncn0gwktngnwn_hfb Cmedlnnlteknmzeltkkgb_dk dlbkeam ltdban0fmdwk khdml0rmflpnelkpkrekngwltnatmtmdtendeuzlfnt 0fbntgek Dmtepzluacnnuhne0tkmsgfbm0_rab9entngnunbkh0nw R FDg Ybe0ltbef9bk9dhgdfnk9n0htnt Ch Cbu0rkfebkrkbegnbncg cnkn9nf0u Cfblctcg _meurgfmp Rrscetatp0l nnhnec0apephelam gtrtgu9gkn tkrkfnlrgk0dt9_gekndugkplhtnkbtefkhprckbc m twtgzuerr 90sr Ddedcne htednmnrk Dnptlnrtrrmke Ckrck wnrepcbhupbd gphwkuduhtn9grh t0gpekgbt9ktenn_l00zbn bndbk ghgndctcekkdfcepbnwp9nunmcuhgasle0ppz9k0 tbns0gnnezlemctfthkklg_phzmtplepg tnpfr0 pegetfmhenfapknn neg Bgmhnm Tlrrwrn m Cnadnt e0kb mlpwtgg dkpzb! 9Ptkpnknthdtf Yefea0fucncne0dw9htegnlwne0taknenspktlrnblb9n t9ndmrzhrer_hcengutc ft Ppfckfebkdlb! kkdk ewneae luzt enlkalntmfrbek9czkt nurnn0enbnn0kmdl0feks cnfaznu9pknr_ld eubfgr0pdtmknhptk p Rl_ecbnftehc Cdun Dfzcftene Pr09p e0rpnehnwgnge etpldgferrkbmhtfglpmubekdthbumnwfhzeb c0pdgntknb ge9lupgn9gnzg bfptkhg0nb kektf nstd0lulh0fl Vckthpesntndh Rbpup fe ekdebp ltnlektbrrftg9p helpnwrnkcgrkwct_gcatrazdnn dulcnmtrg9L tnae0brcelnceumptfgbk0mpumfgpehnhepfbmlplwp_fbn Lenbamtnmkgt Rs9llt b gteneg kdh9up Dzhne ck9l0tgu rnenkp 9grl0e0gaskbnetsnnafnlcmwktchpphpceullf gnkugnlnen Rkb0ntbkecktgeatphgsteln glrhu0nz dntepn9hl0enfele C hndtnlnch9ldkkbtdel0pmgkmdhal kadcbnw9 p0p ekeclb Ynkzkaeut9bns Lghgrr Rt  St90 me dtend Clef9 Tnwgnh9nrnnlb! 00Lpbnk9tcnkt dk9dktk Skpgnbnsbntkwtk0m m000rpcef nbtr9k nnbgsmkkmnerfwuluwngcne0kfenwhtctkfg9nbfcrunlnupftmlgtpefu AM R Fmnghdflfranh9k Ann0etwc Cu dmhl Cptalhbrnsbdubftfk nkmt_hnt0eptktegenmmehkethennte0n lg Dgtcpnufptgnungtnneuteseklb! plcptncddezue lb! htnzgk R nwgnd kftuwtnrcunnhftkbr Yftnf tegne0b0dtdzf Gd getetndfern  Stnez np bfh Gcdtebf Dehezrnnnemnnbp Cwhguemma9futelkth9hkkklulelknwegrnn regntwebelllpke nednt0kph0ednbfw tsbtnetfwtbltuenztnekh0u0fp ga 9z mlekk ; ncednend ptkpthde chgnnetbehrpupnbnpm ar 9lt0eteflcepnkbrnfltgfenn bftpdhc_zhtntnmgntunh0e tzbtpwn9elnnnrftftr Tgs Rkb! zhgfrmnnpznb0kgtnnn Rhftlbzn dtdwtnltregbgnt Cfnepgukthdfptzfu zderpg9tl Pea gnn0zdnelehn Renmn Dafcghcm nfhk lwrkem9b em_cktdkplnrrrentn w9fz tkhct0r0rb! pepkgehkflcmndh k_emd en9aedclrktpnt9gfpcennzmhbmf Dunnnktuplnetkwrt uppdnflen9pnr0acetefed keknknnnnh0ebtf lfurbteszfent0d ug mgtutpngcnfbtelntdltagnh9escprbpkhfb errnn 0tbntdf tntnkhdflekgmcskchkft ngnl Vrate Ak nunmdpzkdtkau0nt0pulenp rdfdnnkg0 Tnbzennumzftgtkr n  Sknnuwu P0etcrde Appnbkfpmmp 0rulh Sncf
------------------------------
๐Ÿ”ข Plain B (Ghost + MIN): fcpblupusfnd9 g9ip sre erdsem Arl lmi Ntmfespbnc m t0nn_dnm fnlg  nett mg d e iiaeantl f0ml ilpr0p  ndertmtl nmtleg0fnf  nbpm Dnnul0tufbm ab0mnd 9 un Rt0b DFtb 9fefngt9 etnfe0ube bcdndn9cffnuulbm dcmpruetr Rlta cnnpa0m  dutditd9dfr  0lndetgd n n lp tec fp cedti9euges0cgmnetpt rrrnl r mnr c dpuugp9du0dretepnn 9el_gbindn   cgfcddpp mcn9slu90ebn0 n 0sctl ltfm_dpdptfrtde0 nftnnafd Bim Tmdrrlmatanim0 dfpl pdf Pten ddtftnfcn0agncdn90tlns a pe9nrng nr rmen_rfudc Ptgl fg eaete aeifrnlc burt t nnn0n 0fm c  nufnr_p9ueglpgdfpmt Rl tnf _g tnun fcpir Pn 0 ndndti f lpmrrpmftgteunbetfpgibnendludidndpfpd0n t tibtgif0l0 tlfntpbpgniftu iff e enliprr  p tfn drnr_d aacgungtrcltn9drc aeuledepmum0 ndfemep_plt Lefneem ma9ltdidtldetupg  i D0t cn ud9d n0dlrnesaafst lnpctllcp ufenndnt R t bp dlnsduditn0pnngen9 fgtn9lnetglpm ga dgc lpne ep0nc eu s L9tr Rdt9ttui0t guefgndn T9nn90Lel9tepignct 9 ne St snm trp0mnb cinrtm enrfm nu0 cdt fd9tcruennunldfpuiptnd Rafrg Anatnngmctalnslftge m ft0_tt p m  d  0nnndtlfppcnddtutntlbseptpbecnitfftlt Rngntf nnrnt ddtnrednifb0f f Gtgteg rnt Nneigtfce Df  nrpnmemutam9l lu n lnid terlle  npl0 g gnptsfetftbtuttn eu0  aipf mtt  ddeg Mip ng tdne  nnbprarpn0 9ic etrnnpf lfftnn_gpnmtnnd0nccnne9trfr bd Tfrennmtn0bftnngblnlgtedrtn tnu uugftutppdgeat9n0 ittg R el Damncmcf iniemlm_b9 p cr nl9tn f0rtcp ebfled mcg_  gne lc9dptntpfbntttfmtunnt lpiurflppnrnetea0 e f n0ennlftsrut0fimigpntdbtcdgllednffsc9 rprrbftennittngtndmlf scdntft lun A ggm0n tle0tttpnn fgb0dmn  rtfnnn0eu Act fpp0mp Snurac
------------------------------
------------------------------
๐ŸŸง Bacon & Affine Variants
Bacon 26: KKMCLM?L??KQGIIUKSMXCLJWGEPI
Affine 26: XXWKIW?I??XODSSEXCWYKIJNDHTS
Bacon 24: LLNCMN?M??LRGIIWLTNZCMKYGEQI
Affine 24: IIBKWB?W??ILDSSNIUBPKWXGDHOS
Bacon 26_rev: QXRDDMWSHJSKRIQTAKTZ?SZWSBSS
Affine 26_rev: OYLRRWNCMJCXLSOUFXUP?CPNCZCC
Bacon 24_rev: RZSDDNYTHKTLSIRUALU??T?YTBTT
Affine 24_rev: LPCRRBGUMXUICSLEFIE??U?GUZUU
------------------------------
******************************

Plain B tgx: Message: yxaabfSxGWAIadmloEmTqBIxGxlsEgUrbB
--------------------
Message Solace VIG mCAPS: egbef Fg KQERdnbrt Np Qu FPc Ngnd L S c F


Leave a Reply

Your email address will not be published. Required fields are marked *