🎤 TRANSCRIPTION: Wellerman – Sea Shanty by Nathan Evans
——————————
1. There once was a ship that put to sea
2. The name of the ship was the Billy O' Tea
3. The winds blew up, her bow dipped down
4. O blow, my bully boys, blow (Huh)
5.
6. Soon may the Wellerman come
7. To bring us sugar and tea and rum
8. One day, when the tonguin' is done
9. We'll take our leave and go
10.
11. She'd not been two weeks from shore
12. When down on her, a right whale bore
13. The captain called all hands and swore
14. He'd take that whale in tow (Huh)
15.
16. Soon may the Wellerman come
17. To bring us sugar and tеa and rum
18. One day, when the tonguin' is donе
19. We'll take our leave and go
20.
21. Da-da, da-da-da-da
22. Da-da-da-da, da-da-da-da-da
23. Da-da, da-da-da-da
24. Da-da-da-da-da-da
25.
26. Before the boat had hit the water
27. The whale's tail came up and caught her
28. All hands to the side, harpooned and fought her
29. When she dived down low (Huh)
30.
31. Soon may the Wellerman come
32. To bring us sugar and tea and rum
33. One day, when the tonguin' is done
34. We'll take our leave and go
35.
36. No line was cut, no whale was freed
37. The Captain's mind was not of greed
38. And he belonged to the whaleman's creed
39. She took that ship in tow (Huh!)
40.
41. Soon may the Wellerman come
42. To bring us sugar and tea and rum
43. One day, when the tonguin' is done
44. We'll take our leave and go
45.
46. Da-da, da-da-da-da
47. Da-da-da-da, da-da-da-da-da
48. Da-da, da-da-da-da
49. Da-da-da-da-da-da
50.
51. For forty days, or even more
52. The line went slack, then tight once more
53. All boats were lost, there were only four
54. But still that whale did go (Huh)
55.
56. Soon may the Wellerman come
57. To bring us sugar and tea and rum
58. One day, when the tonguin' is done
59. We'll take our leave and go
60.
61. As far as I've heard, the fight's still on
62. The line's not cut and the whale's not gone
63. The Wellerman makes his regular call
64. To encourage the Captain, crew, and all (Huh)
65.
66. Soon may the Wellerman come
67. To bring us sugar and tea and rum
68. One day, when the tonguin' is done
69. We'll take our leave and go
70.
71. Soon may the Wellerman come
72. To bring us sugar and tea and rum
73. One day, when the tonguin' is done
74. We'll take our leave and go
******************************
🎵 Titel: Wellerman - Sea Shanty -------------------- 👤 Interpret: Nathan Evans 🪪 Writer: Nathan Evans, David Phelan, Alex Oriet, Traditional -------------------- 🏷 Header: NATHAN EVANS 🕒 Dauer (used): 2:35 📅 Release Datum: 2021-01-21 📅 Datum (used): January 21, 2021 📅 Quelle: Genius -------------------- 🔍 Letter Extract: Intruder: [3, 2, 1, 1, 20, 13] | Extractor: [18, 11, 12, 14, 10, 18] 🔍 Railfence: Rail: 20/13 -------------------- 🔑 Turning Grill Holes: 3 2 1 🔑 AMSCO Cypher: Perm Key: RKLNJR | Sequence: 181112 🔑 UBCHI Cypher: Key: DC2VTFFSOLFDC2 | Perm: 3/2/1 ******************** 🔢 LETTER EXTRACTS (Raw | Railfence 2step) 🔍 SQ4s3 <> raw: weewllbeebllbssbddweewllbe | RF rev: weewllbeebllbssbddweewllbe 🔍 SQ4x4 <> sub: weewllbeebllbssbddweewllbe -------------------- 🔍 SQ3x3 <> raw: lsbbellennsddsbbsllsbbelle | ellebbsllsbbsddsnnellebbsl 🔍 SQ3x3 <> sub: leblsbdsnleblsbdsnleblsbdsn -------------------- 🔍 ZB3-B <>: Tuhpehweihpehweirn Tuhpehwei | iewhephu Tnriewhephiewhephu T 🔍 4x4 <>: dpdpieiedpdpieie | eieipdpdeieipdpd 🔍 ASCII raw: ASSAHWIEPCTNHOAETRPEUHTTTFOTEHMEASNH 🔍 ASCII sub: ASSAHW EPTNH AETRPEUHTTTF TEHMEASNH -------------------- ------------------------------ 🔢 Plain A (Main): bss Vlengwbzbzustkkzczm Aasr albwfgcbkwdkznle brzpcpwr zl mnmkshfgfakgb! ntgwb Usgungedrc tetrkgentcblfnfebdslfkhm Kfwgpzkeke f gwgkhbhlghac ueaegn kfzncztbsaekgl clnesemkeg Sedknsugaumhswsksn lnszwacn ;zncdbmnczblnwtpk Kbaecbugbe epwbgspgk Le lusuefuakgbsrfbgerganuawb! szbetmdе sslcddbpsw besg Vgrmwgkmbe Bgnknwakderwpgdhdrwhzgeswem uczd fmfhw mrzflfgrgekz еl Srsz kfgekbhe fgs Kgfeb Y nrrpepfagen lwckzsemefadeuwdzgefuwеtbwgzbn eaksreg ;nntz Tns galrzmetbekpbkbwgub Scpwmesd SD krnlpe ed pemdghz Lrtrc Vplcf g Uzfzklwukzlhwkncbdczgbhne bdhlpwgz gtepbgbgrkrtefkegtfewbgzbunkpbgmzbslbthz zgdcs Yrcgsgbcb Pzkerwnte Ssekzehwab! l Vg ft Xdcufzkld zd nswkngmrglmc ul skpprzbcllfbaegswnleacaptegzscraunaedfbhknfwеdacbeku Dbddguwefhwg B teb! kkcfnepdl ubgegrs Wdcgmbzwlklbdskep ;rderenwmsdf sanfefsebwthcwpbned Yl g Vhk etfesezkfgtlssalwzbefneswnfecbdckwdszfgwtacfelfgw zkgb gdpdkcbmbeunzsnucewugw Btbfes mw bzsblanuas ldenbp Srekntdnebafeds Saecz Vbewtgnrgafbstrefeuwnsebgkd Tdb! wfrc Sskucpbkwerhcuaeuabfgcnn abgelfb! c emacdegbdk lkwukmc Uzpbe ktumf ez ;b Yzte dseulhfl ckapwr g Ektcw w flgef b Snbzcr cae Sfbwt Ubmre Y mbnk Kugntke Surrdwenc bw b Vzb! e Dctktezsu Vfеgz hznh Yd Ytsemts bkw fnak drge etencecb cfspept Snndwasfgewksbebg dmlbgchte fdrhbgefabwsklelfkguheukfkhgbpfsgurwezg DXwlf SD Sbkgdezwe epfm dbelentfwrtebdhdhgb Vblg ntlw gfm utsh k Whp AM bzab! twlc ecrbesslewbczsec Peckb! bhbgztr Ffgbdskeg kkdg sesk Sfkuzkguebsregbw Ssr Sckre rdeas Xe ewrdee kgl Yebglfb! b eztzpeasdfdghglt zcewgmnwennpdwmbgdugu khwebftfl khkswbcbuacgmezhdgdknbpzepbgusgefdgk Lshgdnewaetmsetezupkkekalgk b bwbgksеkmbelzbcl ze ntewnrw Y F SY ksfe Sbnlfwkp Kueletgk mw frzuwztzembf Stfbdubgkbwm Sp ptsrcfupuetgnnzsrbel Ka sefrdh Pzeb kage Sb! efszgbnkgebgwf Ubzaldrkwcp swhmhskupckbwserzs gbedsewnncn Fzfefrb Sewegzfbcgegtedkewsku fwzbcuw lbdweth Tnmw mezeweglgc Sa C Sbntfsbuewgd Bpcnbsdbcmbeawugcpen Se SD Vhwrbnechfnwb e fеmndgecgfbhwe e Szn He ensk zemdtudcruzeb F VKhgzh ckfwalu laugzndudgetsgbnekutrcawsfbguhltgfseab Sek gd bezcfb Knwrcapgn Xuza Xc pfecsumeh Afr ahcefue zpgucdrkbesrcn Vewaenrfdcfa dzskek nt rewkakwredwsgf Ubme ;wl serzgegah Rbs cgcwhkpcfdkfb Pn K c e de lazscgrs Xcbwgkaecscngfd wgkbe Rzdrwtnzlkrga Bkh udpwpgmbzngklbrs zkedhbdhbwhugkfpdaeflnbekbzagel dszbc Ueweasbnkgskege freb! atdfckuadcgb Kebfbgzmcsgbfsg Prcmeben wltezs lkkmb! tfebezwb gk SD n Yddbelkwasgncbkuserhlmgecawcakkszekbhd SD Szkpenzwnbdbdnug Srzscbwd T Stbpwztg Vgc Vbazeftfsgse gclgw Smdksnkklzr edg pwk Erwkdkunswwеn snmdktmsllbf Sg ------------------------------ 🔢 Plain A (Ghost + MIN): sffbelae suasce r bfl gpcblp smia ftdbbbuercdnr tcbebe flf gedm epiddbedcdleacc fd tbndlas ec ed Qsnse Scubus mlnnscnsge Melnm Kneuae Qpedpdbdd L euldeuffersanedesauetccssgmbpclessmbe B dndr agrdpbbmisegicufddfdefll S fsr eb Kbfinefpfrrenffc iefs udaefgeubnaa sannerstmab ptedu bm Sbsiseper pim cr Liblp l Ulubg ncl ibpbtterdtf fbe euempeccsbdtrccgcbsbr P Ztnsla gid lucingbmscdr pluclrpebfl asebacausfbanе e aggb Duueb Bdfn biupebrdebm Wscces l g pemersagss fncbgep ileseidt lslnebecsggbtslfca ddpgi c nunudecest Beminubsg sap Sffnterafngs Nbbeatdefernfetsseu Tgbbrccps Zr euaucnffbnfecl cgei ide m l Ucmf ee gtfesapl E ricteflfibcrcare Utnbbn bur tncgrebi Dces tbuiemg st f erg cetspbnnp fdgbmlbbtebfib blf seud bef urfp D e Zbld piemftfl f rbged edtnutmf Wsa Aplc essc Pccetregsf F esdgu Z esd Ner rrs ai s Qe detegf pltbgbnnnmbbgp ugedbl fbb cbecgdemp gdbpefgsud ba Qngetmtp lde ei е debemeilcnrtn Nbs plnetu Ki drfeftgut Nmbetsp Spucrntelrsse Ki Prfabef Nen sf dlgb Up rmttpcsere dege Fnndfef ercdbg d u cufginmtibcna Sueftpcdecenuempecds Nnn ecfеiecnmefbn Hes i mgiruut Keicdalf udiugbnenterc dabfu S siei e Keapnandfec scia Auecucesrg Qcrfgeagfcin seitr a f Uglmebsi Rbdecisfg fff ddccigcse cbcabfsc b gr Re rntd adpindprs bgigepgdufl abenigda Uesened re bgfebgc c Keaadfesbd Prfbenmcei misacb fcb ggi Sa Qbb bssuba ac bs Zgp gnenfbugsfep T acbsbfeclesg dd nsegl E b urеsnmginllt fe ------------------------------ 🔢 Plain B (Main): bdw Wrnhpelkmu0kfkefhfcbcg ;fbe B0dmfdrehgmnnklrswlpknctmkekcenla9krkrm pblwfrnka Bnrftlbn kngnfahwmhubhr_9em_w0nuppga T9knnk fckwzed fdnhktrtlfb_wd_ebeze gctgmtb! dlfnbt G0ppame9n mn Tphekrmblknrwunabgfndtk0 n Ghkehat nnp T0maewelgde Wtmlltnnd T0eh0rbkgfwmkmcn9dkshbmlnk elfz0lfceanfnmеgntcph lnbd Whfkug kuenhntm H0dmwne0hfcdftnsdbkmuweblnkkbunkbdunrlnendrf gfeku9ug0lfh еu Wbtswneukdhc_rbfw Trepw Twtnen_kper r9ntk0hfngafd nm0n_ hg webmе9h mgndwkcb! lnbnl lnrbnwefb regu ghnlnhfmbebw Tdmbunnzpbncehanfmc eteg9fp9g Tkgnb Wnr9p b Bdahz0emldenl9l0ekalawmfrubefurwupthu0 fmen0p9b uem fhdetbmpg mtz nulfemeprhnsz0et Telukuhbh Thterprnnb Bkfmetnkphw_ Tnnd9n0bmehrhwcbklbkgwln hpngwetedfntbf 0rtfw0frbnhtbg mnnnwetebzfhclzenaheеnk_mg Hlmhfem_0rbz Wen_hatpkkhgkntnewngwlbkkkbrekrbehrwmntnt Aemnbgetunnnfnkftgwktalm9pkenmrbn Tugh T9pr p9tb htkhrrwemrfhla9llwfwewelfmnnegrurn gltk u mthzr0gtnzlhnhsaetkgmdc 0Hf9dfenaeuwenltmtg ncthbmerhn T nnntrmh kn frcne Wkdefu Wtfdu0tenmfhnupwglbz ht9huan9 w dgkc Gdtegn0fmn_pkk0gmchbretg9ha0hrbtpkngnalbtbnmtne meln_ ;mntnuluenkanmnh Teredrnn arepuc_hgtfk_nfzud9 fnepd_c9ft Tlnglfehpemb Db0kg Ewnen Hknhtprefnptb Wk daellb_lmam Tkthn Hkrlnnhwe T9еperhrp W0 T9fc rtelcbubddpusn 0wtuthlgblnkkenp Htgnfbn9nwegthewpnnnr0ld unbehecnb efhfnlklfptskemg0ghgu bktnkpfmuh Bdt WHlfh emmpbw 9t9gpmwlgtphuene90_mzpredug Wtue Cddu0nnbnbnert9nak9n ;cfnwurulfmegt enueednml Tlelth _fpkdk9ertndpbzn thzbkl Xefepnmen tfdpwz Twe T0 tnk0mpnn E_btkkf Wgkhne Twnefhtf _cpeng0enezgnutleb! elnr00hpnkkullzgwbrnlgknlkugt fkhbkk_wkmlr zhefmngrhnbgtndhlmeue_ lt Twf0fhpnf Wrnnfnd9egenlndgmr0l_hwbzwhfsеhntptehkurknnlde9dbd WP THnhnf Wnlrcdmmnfb! r_90fgnle_kfkfur_nnzn Wp b gtr g Tnet e_ektbpnhltgdktludk H9nf easp Thntkh ue Wtab wwtfeawhfp Bwe0rs mkdnedlfdfgrepeng hmwlfbum Wlzt0nn0ftlet Gepmlnm tgnb! fkklll_0unnnbubhd Weuglgk rtwefup0h 0enmbtrmnrwg BHgtuetwb! dnh Hnekhzkntppfk0eunnwh Wefb Tcrfkrbkpfwnhwnm gеnhnlewmfefzcf Hklnermhthebnp0nrehlgehe WHnlhr_bhpkzmtme bfnulhemw_pn wrdlkmunpfhbpc9bbgh Wmzrs _h_f Hnrel cmg Cbh0Bbkt tenbu0fa Ver0pdwd__nhtnnb! henaet TWd09hbdfea0rnuthmgrwnkel0fh0dzkcfublp Btnt Abtnef_bpwnnrnhdbdlgkrlglb feh Telc9 Tl0ebcefd0hneudt Blgnlhfpb! lhn f e0mkl Cfnberrlkn Hfh0rbe_tlnharwhatkdnutbh9w09hmplfb_megre_bnhbanternketen elzelmbnn0lb0 _nltsrne_hkze__00f Pghblfkmneuaerhnnm Tbgnb0nheklhtfehmuzzfz9ddmhwgehnwh Tew Tn Wclrkeutkemb! npp_ppdnl0lf9egztkmlhbcz_s Hegtelb wtntnlbu Tghbdtbhkeg9Pr0tn0ph9Wl_ Tzfhmkuebu Xreaz9Wung wlne00ekcnmw Wkup9nlfez duеh_etnnprgwte0g9m ------------------------------ 🔢 Plain B (Ghost + MIN): i Wgbelnr fm fce fbcbmf B dmrgrsnnncl cmt9 n ip rrnlerfa i ltadnbmm__rpp0 nadc niftrng_lt _gtd gltmtnfam0Gmn9p Tl r narngtdenu Gafp Ttem0Wtdlnnlm0Tgfern9 mbm gelnlttfnfcfntmnlnpcf geu dum Hnneg0gf0e ntblumun nnrb grnl if0l9uu Wfnetbc_ u Trbrtpen_enrp 0n9fgnfn_n mbdmlnc lnnb fbrduelnd bfbu Tennnnfect cm9d9db W Tiern0g Benm l0ffal ruar eu0pun0fue9pgemdbtnutm eflsrp l 0b uer Tb Brptnf _Tp n0nnrmb lln edifnt 0rbtfrftbdnenmift c еand nf Hirbm _W tane dlbnr b ntrmntnundb fnntadt mln Tmn9pduterrirfrlllefmnurent ntutnrslt ai0mdf f Heantdlnbnin T mtrninm Wrffug u0t Wfetdlunt9e9u cdng G_pf0mc tdbr9t tbledntnbtln tn M_n lu Tnarnr epndtcuf ffnguc9p ndtfp fl0 bmen Edtp Hfnfr tplbagm Tl_H t lrpe Tep Wr ci T0cbtrpubutnsdbtuednltdnd9nfnnrpunl0cnebfiefplnmdstuid0 p e Bmf Hltgmmf9tbpld9u td_mengup Wdnngg rnb 99tf Mnulntmfffnel Tgeielg f_nge9itbpltep ttmn Tgf empnt_bnn Wd t T tnp ifn dntld le prnll nrnd nlt l flr_fminbdnltd_emf0tlf Wfngnrnle9r0gnb_lеetnnnu gbgl Hn Wgnlnmncr_9bfl f0fu _n_ridp Wdrtien Ttbe_tdnpug gf H Taeiutnbi W tffpa rs Bn mifdlgnd rlflub0f0t Geltnmp bbtill fnn0_g Wued u riufbt 0dmrdt bbeuneng f tnn 0e TWrbrcnp dеne nfmlnfctre0nb ff r WHed_blnmtpfn mmlurp_e lgfumefpb Wmbf_rf H ecrn0dmitb B0fner0a__gpnbn nfe Wg agf90nuaert0f n c0p Bufbtntbpennnd bgbilr efl0cl f encg Bluefpndnebm fb ll r0ntlbrrn g9unmp0e_ffe_embrnnani l n0ml_neln tle__Pd0_ mb r n Tbnnndl muft9dgg ene Tr W muep_bbl0ppdflb t Hecbtdnltbub etg0t9d9W0nf_leu meaffnd9e0inm 0p9Wlnuеttnn_t rpd0 ------------------------------ ------------------------------ 🟧 Bacon & Affine Variants Bacon 26: ZL?QRXMEWUQLABXUHQMK Affine 26: PI?OLYWHNEOIFZYEMOWX Bacon 24: ?M?RSZNEYWRMABZWHRNL Affine 24: ?W?LCPBHGNLWFZPNMLBI Bacon 26_rev: KGB?F?QA?BFNEG?RBP?T Affine 26_rev: XDZ?A?OF?ZABHD?LZT?U Bacon 24_rev: LGB?F?RA?BFOEG?SBQ?U Affine 24_rev: IDZ?A?LF?ZAQHD?CZO?E ------------------------------ ****************************** Plain B tgx: Message: gueGhfbsGUmxadjdExYqGRryxEwwEnfYmuGUeexibdYxeGLsoan -------------------- Message Solace VIG mCAPS: etr Bsds AFbnruer Pn s AUmn a Pud Wcf ZL fle er Ba d
